PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G1126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 331aa    MW: 36742 Da    PI: 4.9458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G1126genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25e-153481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l+++    G g+W+ +ar  g+ R++k+c++rw +yl
      Gh_A07G1126 34 KGLWSPEEDDKLINYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 81
                     678*******************************************97 PP

2Myb_DNA-binding52.61.1e-1687130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+v+++  lG++ W+ Ia++++ gRt++++k++w++
      Gh_A07G1126  87 RGAFSPQEEELIVHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 130
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2272981IPR017930Myb domain
SuperFamilySSF466897.81E-2832128IPR009057Homeodomain-like
SMARTSM007172.3E-113383IPR001005SANT/Myb domain
PfamPF002498.5E-143481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-223588IPR009057Homeodomain-like
CDDcd001672.71E-93781No hitNo description
PROSITE profilePS5129425.53482136IPR017930Myb domain
SMARTSM007179.0E-1686134IPR001005SANT/Myb domain
PfamPF002495.3E-1587130IPR001005SANT/Myb domain
CDDcd001675.73E-1189129No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2589137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MMRKPDPSVK VISGGNTNTN TNTNNGTTTN KLRKGLWSPE EDDKLINYML TNGQGCWSDV  60
ARNAGLQRCG KSCRLRWINY LRPDLKRGAF SPQEEELIVH LHSILGNRWS QIAARLPGRT  120
DNEIKNFWNS TIKKRLKNLS STPSPKVSNS STSEPNNDAM QGLMSMQEQG ILPMYMDLPS  180
ASSNSSLQSM VLNHTGNSLP MLEHDLNVFG ASGYFDPASC VTQVGVNGES FYGENEMLGT  240
VENGAERELY VPPLESIGEN LKTENTTVDV WNINNNPFNI INSKNNNSKS DNIGNAAVGN  300
FWIGEEIKVG EWDLEDLMKD VSSIPFLDFQ S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-273213625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5835913e-80JX583591.1 Gossypium hirsutum clone NBRI_GE16676 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478812.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV24e-72MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D2N9D20.0A0A0D2N9D2_G
STRINGVIT_06s0004g02110.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.19e-69myb domain protein 46